Description
Product Details
Product details
- Product name: LL-37
- Quantity: 5 mg
- Form: Lyophilized powder
- Container: Sealed research vial
- Peptide class: Human cathelicidin-derived host-defense peptide
- Sequence length: 37 amino acids
- Appearance: White to off-white lyophilized material
- Purity: 99%+ when confirmed by the product’s batch-specific COA
- Testing: Refer to the applicable Certificate of Analysis
- Intended use: Laboratory research and analytical testing only
- Human use: Not permitted
- Prescription status: Not an approved drug or medication
Chemical information
- Full name: Human cathelicidin antimicrobial peptide LL-37
- Alternative names: LL37, Cathelicidin LL-37, hCAP18-derived peptide, CAP-18
- PubChem CID: 16198951
- Molecular formula: C₂₀₅H₃₄₀N₆₀O₅₃
- Molecular weight: Approximately 4,493 g/mol
- Peptide length: 37 amino acids
- Peptide structure: Linear, cationic, amphipathic peptide with environment-dependent α-helical characteristics
- Amino-acid sequence: [LL-37, 37 aa]
Technical identifiers are supported by PubChem and the reviewed human cathelicidin entry from UniProt.
Composition
Each vial contains:
- LL-37 peptide: 5 mg
- Form: Lyophilized research material
Any excipients, counterions, residual solvents, or other batch-specific details should be listed according to the applicable Certificate of Analysis rather than assumed.
For research use only. Not for human or veterinary use. Not intended for ingestion, injection, diagnosis, treatment, prevention, or cure of any disease. This product has not been evaluated or approved by the FDA for clinical use.
Storage
Store the unopened vial in a cool, dry environment away from direct light. After reconstitution, follow established laboratory storage protocols and the information provided with the product.
Important Notice
This product is intended strictly for laboratory research and analytical purposes only. It is not intended for human or veterinary use, consumption, diagnosis, treatment, prevention, or cure of any disease or medical condition. Not for use in food, drugs, cosmetics, or household products. Purchasers must be qualified researchers and are responsible for proper handling, storage, and use in accordance with all applicable laws and regulations.
Research Focus
Intended Use
This product is intended exclusively for:
- Laboratory research
- Analytical testing
- In vitro experimentation
- Preclinical investigative studies
Handling Guidelines
- Handle using appropriate laboratory safety procedures
- Utilize proper protective equipment (PPE) during handling
- Reconstitute and store according to standard laboratory protocols
- Avoid repeated freeze-thaw cycles
Storage Conditions
- Store in a cool, dry, and dark environment
- Refrigeration recommended for extended storage
- Ensure vial remains tightly sealed when not in use
Quality Assurance
Each batch is subject to internal quality control procedures, which may include:
- Purity verification
- Identity confirmation
- Visual inspection
Documentation such as Certificates of Analysis (COA) may be available upon request.
Compliance Notice
- For Research Use Only
- Not for human or veterinary use
- Not intended to diagnose, treat, cure, or prevent any disease
- Not a drug, food, or cosmetic product
This product is sold strictly for use by qualified professionals in controlled research settings.
Purchaser Acknowledgment
By purchasing this product, the buyer confirms that:
- They are a qualified researcher or purchasing on behalf of one
- They understand the nature of research-use-only materials
- They will comply with all applicable laws and regulations regarding handling and use
HappyPeps maintains strict sourcing and handling standards to ensure consistency and reliability across all research materials.
Specification Summary
LL-37 5 mg — Research Peptide
Product title
LL-37 5 mg | Lyophilized Research Peptide
Short description
LL-37 is a synthetic, 37-amino-acid research peptide modeled after the naturally occurring human cathelicidin peptide. It is studied in laboratory settings for its interactions with microbial membranes, innate immune signaling, inflammatory pathways, cellular migration, and tissue-repair mechanisms.
Supplied as 5 mg of lyophilized powder in a sealed research vial.
Full product description
LL-37 is a cationic, amphipathic peptide consisting of 37 amino-acid residues. It is the active C-terminal peptide derived from the human cathelicidin antimicrobial protein, also known as hCAP18.
The name LL-37 refers to its two N-terminal leucine residues—“LL”—and its total length of 37 amino acids. In experimental environments, LL-37 is extensively studied as a host-defense peptide because of its ability to interact with biological membranes and participate in several innate immune processes.
Current research examines LL-37 in connection with microbial membrane disruption, biofilm models, chemotactic signaling, cytokine regulation, angiogenic pathways, cellular migration, and experimental tissue-repair responses. Its biological activity can vary depending on concentration, experimental model, solution conditions, and the presence of salts, serum, or other biological components.
This product is supplied as a lyophilized powder and is intended exclusively for qualified laboratory research and analytical applications.
Research focus
LL-37 is commonly investigated in laboratory models involving:
- Host-defense and innate immune signaling
- Peptide–membrane interactions
- Bacterial membrane permeability
- Experimental bacterial and fungal models
- Biofilm formation and disruption
- Cytokine and inflammatory signaling
- Chemotaxis and immune-cell recruitment
- Keratinocyte and epithelial-cell migration
- Angiogenic signaling pathways
- Experimental wound-closure mechanisms
- Structure–activity relationships
- Development of LL-37-derived peptide analogues
LL-37 has complex, context-dependent biological behavior. Experimental findings should not be interpreted as evidence of safety or effectiveness in humans.






There are no reviews yet.